General Information

  • ID:  hor006782
  • Uniprot ID:  Q9MZG3
  • Protein name:  Diazepam-binding inhibitor-like 5
  • Gene name:  DBIL5
  • Organism:  Bos taurus (Bovine)
  • Family:  ACBP family
  • Source:  Animal
  • Expression:  Specifically expressed in late haploid male germ cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process
  • GO CC:  GO:0005737 cytoplasm

Sequence Information

  • Sequence:  MCQVEFEMACAAIKQLKGPVSDQEKLLVYSYYKQATQGDCNIPAPPATDLKAKAKWEAWNENKGMSKMDAMRIYIAKVEELKKNEAG
  • Length:  87(1-87)
  • Propeptide:  MCQVEFEMACAAIKQLKGPVSDQEKLLVYSYYKQATQGDCNIPAPPATDLKAKAKWEAWNENKGMSKMDAMRIYIAKVEELKKNEAG
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the energy metabolism of the mature sperm.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9MZG3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9MZG3-F1.pdbhor006782_AF2.pdbhor006782_ESM.pdb

Physical Information

Mass: 1132256 Formula: C431H687N113O130S8
Absent amino acids: H Common amino acids: AK
pI: 8.02 Basic residues: 13
Polar residues: 20 Hydrophobic residues: 28
Hydrophobicity: -55.63 Boman Index: -13189
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 67.47
Instability Index: 4576.32 Extinction Coefficient cystines: 17085
Absorbance 280nm: 198.66

Literature

  • PubMed ID:  11024294
  • Title:  Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution.